Urocortin III, mouse

Not For Human Use, Lab Use Only.

C186H312N52O52S2

SKU KSP-25885 Category

Sequence 3 letters:

Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2

Sequence:

FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI

Cas No. :

Molecular Formula:

C186H312N52O52S2

Molecular Weight:

4173.01

Description

Urocortin III was found in mouse (Mus musculus).

Reference

  • K.Lewis et al., Proc. Natl. Acad. Sci. USA, 98, 7570 (2001)
Categories:
Product Quote Form
Please enable JavaScript in your browser to complete this form.
Name
Email