Thrombocidin-1 antimicrobial variant, TC-1

Not For Human Use, Lab Use Only.

SKU KSP-32766 Category

Sequence:

AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDES

References:

Product Quote Form
Please enable JavaScript in your browser to complete this form.
Name
Email