Skin peptide tyrosine-tyrosine

Not For Human Use, Lab Use Only.

C190H293N53O57S

SKU KSP-25526 Category

Sequence 3 letters:

H-Tyr-Pro-Pro-Lys-Pro-Glu-Ser-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Met-Asn-Lys-Tyr-Leu-Thr-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

Sequence:

YPPKPESPGEDASPEEMNKYLTALRHYINLVTRQRY

Cas No. :

Molecular Formula:

C190H293N53O57S

Molecular Weight:

4263.6

Description

Skin peptide tyrosine-tyrosine has Antifungal activity. Skin peptide tyrosine-tyrosine was found in the South American arboreal frog Phyllomedusa bicolor.

Reference

  • Mor A, Chartrel N, Vaudry H, Nicolas P. Skin peptide tyrosine-tyrosine, a member of the pancreatic polypeptide family: isolation, structure, synthesis, and endocrine activity. Proc Natl Acad Sci USA. 1994;91(22):10295-9.
Categories:
Product Quote Form
Please enable JavaScript in your browser to complete this form.
Name
Email