Peptide YY

Not For Human Use, Lab Use Only.

C193H292N58O54

SKU KSP-26194 Category

Sequence 3 letters:

H-Tyr-Pro-Ala-Lys-Pro-Gln-Ala-Pro-Gly-Glu-His-Ala-Ser-Pro-Asp-Glu-Leu-Asn-Arg-Tyr-Tyr-Thr-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Phe-NH2

Sequence:

YPAKPQAPGEHASPDELNRYYTSLRHYLNLVTRQRF

Cas No. :

Molecular Formula:

C193H292N58O54

Molecular Weight:

4288.6

Description

The source of Peptide YY is bovine (Bos taurus).

Reference

Categories:
Product Quote Form
Please enable JavaScript in your browser to complete this form.
Name
Email