Parabutoporin, PP, Non-disulfide-bridged peptide 3.2, NDBP-3.2

Not For Human Use, Lab Use Only.

SKU KSP-33387 Category

Sequence:

FKLGSFLKKAWKSKLAKKLRAKGKEMLKDYAKGLLEGGSEEVPGQ

References:

Product Quote Form
Please enable JavaScript in your browser to complete this form.
Name
Email