Pandinin-1, Pin1, Non-disulfide-bridged peptide 3.4, NDBP-3.4

Not For Human Use, Lab Use Only.

SKU KSP-33353 Category

Sequence:

GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPT

References:

Product Quote Form
Please enable JavaScript in your browser to complete this form.
Name
Email