Neuropeptide YY

Not For Human Use, Lab Use Only.

C191H295N53O56

SKU KSP-25443 Category

Sequence 3 letters:

H-Tyr-Pro-Pro-Lys-Pro-Glu-Ser-Pro-Gly-Glu-Asn-Ala-Thr-Pro-Glu-Glu-Leu-Ala-Lys-Tyr-Ile-Ala-Asp-Leu-Arg-His-Tyr-Ile-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

Sequence:

YPPKPESPGENATPEELAKYIADLRHYINLVTRQRY

Cas No. :

Molecular Formula:

C191H295N53O56

Molecular Weight:

4229.6

Description

The source of Neuropeptide YY is Burmese python (Python molurus).

Reference

Categories:
Product Quote Form
Please enable JavaScript in your browser to complete this form.
Name
Email