Sequence 3 letters:

Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr

Sequence:

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

Cas No. :

Molecular Formula:

C₁₈₉H₂₈₅N₅₅O₅₇S

Molecular Weight:

4271.5

Description

N-terminal truncation enhances peptide antimicrobial activity. It showed a moderate activity against E. coli ATCC 25922 (MIC 46.5 ug/ml) and very weak activity against S. mutans NCTC 10449, L acidophilus NCTC 1723, E. faecalis NCTC 12697, P. aeruginosa ATCC 27853, and C. albicans NCTC 3179 (MIC 125-280 ug/ml). 3D structure was determined at pH 3.2 and 37oC by 2D NMR. Residues 13-36 form a well-defined amphipathic helix. Dimers co-exist in the NMR solution. You can rotate, zoom, and view the 3D structure here in the PDB. Updated 5/2014; Jan2015. Neuropeptide Y has Antifungal activity. The source of Neuropeptide Y is brain, Homo sapiens.

Reference

• Minth CD, Bloom SR, Polak JM, Dixon JE. Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine. Proc Natl Acad Sci USA. 1984;81(14):4577-81.