M-zodatoxin-Lt6a, Latarcin 6a, Ltc-6a

Not For Human Use, Lab Use Only.

SKU KSP-32624 Category

Sequence:

QAFQTFKPDWNKIRYDAMKMQTSLGQMKKRFNL

References:

Product Quote Form
Please enable JavaScript in your browser to complete this form.
Name
Email