Human Cathelicidin, CAP-18, hCAP-18, LL-37

Not For Human Use, Lab Use Only.

SKU KSP-32992 Category

Sequence:

[LL-37, 37 aa]

References:

Product Quote Form
Please enable JavaScript in your browser to complete this form.
Name
Email