Esculentin-2-OG5 antimicrobial peptide

Not For Human Use, Lab Use Only.

SKU KSP-26172 Category

Sequence 3 letters:

Gly-Leu-Phe-Thr-Leu-Ile-Lys-Gly-Ala-Ala-Lys-Leu-Ile-Gly-Arg-Thr-Val-Ala-Lys-Glu-Ala-Gly-Lys-Thr-Gly-Leu-Glu-Leu-Met-Ala-Cys-Lys-Ile-Thr-Asn-Gln-Cys

Sequence:

GLFTLIKGAAKLIGRTVAKEAGKTGLELMACKITNQC

Cas No. :

Molecular Formula:

undefined

Molecular Weight:

undefined

Description

Esculentin-2-OG5 antimicrobial peptide has Antimicrobial activity. The source of Esculentin-2-OG5 antimicrobial peptide is Rana grahami [Yunnanfu frog].

Reference

  • Li J, Xu X, Xu C, et al. Anti-infection peptidomics of amphibian skin. Mol Cell Proteomics. 2007;6(5):882-94.
Categories:
Product Quote Form
Please enable JavaScript in your browser to complete this form.
Name
Email