Cathelin-related antimicrobial peptide, Cramp, Cathelin-like protein, CLP

Not For Human Use, Lab Use Only.

SKU KSP-33591 Category

Sequence:

GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ

References:

Product Quote Form
Please enable JavaScript in your browser to complete this form.
Name
Email