Beta-defensin 4A, Beta-defensin 2, BD-2, hBD-2, SAP1
Not For Human Use, Lab Use Only.
SKU
KSP-33690
Category Antimicrobial Peptides
Bulk purchasing
Send email to vip@kirklandpeptide.com to get VIP discount!
Sequence:
GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
References:
-
Bals R,Wang X,Wu Z,Freeman T,Bafna V,Zasloff M,Wilson JM
J Clin Invest, 1998, 874-880
Human beta-defensin 2 is a salt-sensitive peptide antibiotic expressed in human lung.
-
Sun L,Finnegan CM,Kish-Catalone T,Blumenthal R,Garzino-Demo P,La Terra Maggiore GM,Berrone S,Kleinman C,Wu Z,Abdelwahab S,Lu W,Garzino-Demo A
J Virol, 2005, 14318–14329
Human beta-defensins suppress human immunodeficiency virus infection: potential role in mucosal protection.
-
Joly S,Maze C,McCray PB Jr,Guthmiller JM
J Clin Microbiol, 2004, 1024–1029
Human beta-defensins 2 and 3 demonstrate strain-selective activity against oral microorganisms.
-
Singh PK,Jia HP,Wiles K,Hesselberth J,Liu L,Conway BA,Greenberg EP,Valore EV,Welsh MJ,Ganz T,Tack BF,McCray PB Jr
Proc Natl Acad Sci U S A, 1998, 14961–14966
Production of beta-defensins by human airway epithelia.
-
Schulz A,Klüver E,Schulz-Maronde S,Adermann K
Biopolymers, 2005, 34-49
Engineering disulfide bonds of the novel human beta-defensins hBD-27 and hBD-28: differences in disulfide formation and biological activity among human beta-defensins.
-
Liu CB,Shan B,Bai H,Tang J,Yan LZ,Ma YB
Zool Res, 2015, 41-47
Hydrophilic/hydrophobic characters of antimicrobial peptides derived from animals and their effects on multidrug resistant clinical isolates.
-
Corrales-Garcia L,Ortiz E,Castaneda-Delgado JE,Rivas-Santiago B,Corzo G
Protein Expr Purif, 2013, 33-43
Bacterial expression and antibiotic activities of recombinant variants of human ?-defensins on pathogenic bacteria and M. tuberculosis.
-
Zharkova MS,Orlov DS,Golubeva OY,Chakchir OB,Eliseev IE,Grinchuk TM,Shamova OV
Front Cell Infect Microbiol, 2019, 128
Application of Antimicrobial Peptides of the Innate Immune System in Combination With Conventional Antibiotics-A Novel Way to Combat Antibiotic Resistance?
-
Ting DSJ,Goh ETL,Mayandi V,Busoy JMF,Aung TT,Periayah MH,Nubile M,Mastropasqua L,Said DG,Htoon HM,Barathi VA,Beuerman RW,Lakshminarayanan R,Mohammed I,Dua HS
Sci Rep, 2021, 18304
Hybrid derivative of cathelicidin and human beta defensin-2 against Gram-positive bacteria: A novel approach for the treatment of bacterial keratitis.
Categories: Antimicrobial Peptides