Beta-defensin 14/mBD-14 (3-45)[C,16,21,31,39A]

Not For Human Use, Lab Use Only.

SKU KSP-33751 Category

Sequence:

PKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKCARKKK

References:

Product Quote Form
Please enable JavaScript in your browser to complete this form.
Name
Email