Beta-defensin 103, Beta-Defensin 3, hBD-3
Not For Human Use, Lab Use Only.
SKU
KSP-33301
Category Antimicrobial Peptides
Bulk purchasing
Send email to vip@kirklandpeptide.com to get VIP discount!
Sequence:
GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
References:
-
Hinrichsen K,Podschun R,Schubert S,Schröder JM,Harder J,Proksch E
Antimicrob Agents Chemother, 2008, 1876-1879
Mouse beta-defensin-14, an antimicrobial ortholog of human beta-defensin-3.
-
Hoover DM,Wu Z,Tucker K,Lu W,Lubkowski J
Antimicrob Agents Chemother, 2003, 2804-2809
Antimicrobial characterization of human beta-defensin 3 derivatives.
-
Joly S,Maze C,McCray PB Jr,Guthmiller JM
J Clin Microbiol, 2004, 1024-1029
Human beta-defensins 2 and 3 demonstrate strain-selective activity against oral microorganisms.
-
Harder J,Bartels J,Christophers E,Schröder JM
J Biol Chem, 2001, 5707-5713
Isolation and characterization of human beta -defensin-3, a novel human inducible peptide antibiotic.
-
Klüver E,Schulz-Maronde S,Scheid S,Meyer B,Forssmann WG,Adermann K
Biochemistry, 2005, 9804-9816
Structure-activity relation of human beta-defensin 3: influence of disulfide bonds and cysteine substitution on antimicrobial activity and cytotoxicity.
-
Li T,Guo F,Wang Q,Fang H,Li Z,Wang D,Wang H
PLoS One, 2015, e0117913
N-terminus three residues deletion mutant of human beta-defensin 3 with remarkably enhanced salt-resistance.
-
Kraszewska J,Beckett MC,James TC,Bond U
Appl Environ Microbiol, 2016, 4288-4298
Comparative Analysis of the Antimicrobial Activities of Plant Defensin-Like and Ultrashort Peptides against Food-Spoiling Bacteria
-
Corrales-Garcia L,Ortiz E,Castaneda-Delgado JE,Rivas-Santiago B,Corzo G
Protein Expr Purif, 2013, 33-43
Bacterial expression and antibiotic activities of recombinant variants of human ?-defensins on pathogenic bacteria and M. tuberculosis.
-
Zharkova MS,Orlov DS,Golubeva OY,Chakchir OB,Eliseev IE,Grinchuk TM,Shamova OV
Front Cell Infect Microbiol, 2019, 128
Application of Antimicrobial Peptides of the Innate Immune System in Combination With Conventional Antibiotics-A Novel Way to Combat Antibiotic Resistance?
-
Yu W,Ning N,Xue Y,Huang Y,Guo F,Li T,Yang B,Luo D,Sun Y,Li Z,Wang J,He Z,Cheng S,Zhang X,Wang H
Front Microbiol, 2021, 663151
A Chimeric Cationic Peptide Composed of Human β-Defensin 3 and Human β-Defensin 4 Exhibits Improved Antibacterial Activity and Salt Resistance.
-
Nehls C,Böhling A,Podschun R,Schubert S,Grötzinger J,Schromm AB,Fedders H,Leippe M,Harder J,Kaconis Y,Gronow S,Gutsmann T
Biochim Biophys Acta, 2020, 183273
Influence of disulfide bonds in human beta defensin-3 on its strain specific activity against Gram-negative bacteria.
-
Ting DSJ,Goh ETL,Mayandi V,Busoy JMF,Aung TT,Periayah MH,Nubile M,Mastropasqua L,Said DG,Htoon HM,Barathi VA,Beuerman RW,Lakshminarayanan R,Mohammed I,Dua HS
Sci Rep, 2021, 18304
Hybrid derivative of cathelicidin and human beta defensin-2 against Gram-positive bacteria: A novel approach for the treatment of bacterial keratitis.
Categories: Antimicrobial Peptides