Antifungal protein Afp [G29P,S30W,A31F,A32W,K34INS], dAfpB9

Not For Human Use, Lab Use Only.

SKU KSP-55277 Category

Sequence:

LSKYGGQCSLKHNTCTYLKGGRNVIVNCPWFWNKKRCKSDRHHCEYDEHHRRVDCQTPV

References:

Product Quote Form
Please enable JavaScript in your browser to complete this form.
Name
Email